wanglab/bioreason-pro-rl
Reinforcement Learning • 4B • Updated • 281 • 7
protein_id stringlengths 6 10 | protein_names stringlengths 2 1.26k | protein_function stringlengths 9 5.75k ⌀ | organism stringclasses 589
values | length float64 11 16k | subcellular_location stringlengths 7 6.16k ⌀ | sequence stringlengths 11 16k | go_ids listlengths 2 494 | go_bp listlengths 0 437 ⌀ | go_mf listlengths 0 59 ⌀ | go_cc listlengths 0 67 ⌀ | structure_path stringlengths 25 29 ⌀ | string_id stringlengths 10 27 ⌀ | interaction_partners listlengths 1 668 ⌀ | interpro_ids listlengths 1 20 ⌀ | interpro_location stringlengths 3 529 | ppi_formatted stringlengths 0 811 | interpro_formatted stringlengths 0 1.79k | go_pred stringlengths 369 15k |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Q13542 | Eukaryotic translation initiation factor 4E-binding protein 2 | Repressor of translation initiation involved in synaptic plasticity, learning and memory formation. Regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperp... | Homo sapiens (Human) | 120 | Cytoplasm. Nucleus | MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI | [
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0032838",
"GO:0035770",
"GO:0036464",
"GO:0042995",
"GO:0043005",
"GO:0043226",
"GO:0043228",
"GO:0043229",
"GO:0043232",
"GO:0071598",
"GO:0099080",
"GO:0099568",
"GO:0110165",
"GO:0120025",
"GO:0120111"
] | [] | [] | [
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0032838",
"GO:0035770",
"GO:0036464",
"GO:0042995",
"GO:0043005",
"GO:0043226",
"GO:0043228",
"GO:0043229",
"GO:0043232",
"GO:0071598",
"GO:0099080",
"GO:0099568",
"GO:0110165",
"GO:0120025",
"GO:0120111"
] | AF-Q13542-F1-model_v6.pdb | 9606.ENSP00000362314 | [
"Q96E95",
"Q8N102",
"Q9P2P3",
"O60516",
"Q6IBN3",
"Q7Z721",
"Q9Y4I3"
] | [
"IPR008606"
] | {"IPR008606": [7, 120]} | - Eukaryotic translation initiation factor 4E
- Regulatory-associated protein of mTOR
- Serine/threonine-protein kinase mTOR
- Eukaryotic translation initiation factor 4E-binding protein 1
- Eukaryotic translation initiation factor 4E-binding protein 3
- Ribosomal protein S6 kinase beta-1
- Eukaryotic translation initi... | - IPR008606: Eukaryotic translation initiation factor 4E binding (family) [7-120] | Molecular Function (MF): GO:0003674 (molecular function), GO:0045182 (translation regulator activity), GO:0005488 (binding), GO:0030371 (translation repressor activity), GO:0005515 (protein binding), GO:0031369 (translation initiation factor binding), GO:0008190 (eukaryotic initiation factor 4E binding)
Biological Proc... |
P97288 | 5-hydroxytryptamine receptor 4 | G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (By similarity). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide- binding proteins (G proteins) and modulates the activity of downst... | Mus musculus (Mouse) | 388 | Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Note=Interaction with SNX27 mediates recruitment to early endosomes, while interaction with NHERF1 and EZR might target the protein to specialized subcellular regions, such as microvilli | MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFR... | [
"GO:0001894",
"GO:0003008",
"GO:0006810",
"GO:0007154",
"GO:0007165",
"GO:0007186",
"GO:0007586",
"GO:0007589",
"GO:0008150",
"GO:0009987",
"GO:0010669",
"GO:0022600",
"GO:0023052",
"GO:0030277",
"GO:0032501",
"GO:0032941",
"GO:0042592",
"GO:0044087",
"GO:0046903",
"GO:0048871"... | [
"GO:0001894",
"GO:0003008",
"GO:0006810",
"GO:0007154",
"GO:0007165",
"GO:0007186",
"GO:0007586",
"GO:0007589",
"GO:0008150",
"GO:0009987",
"GO:0010669",
"GO:0022600",
"GO:0023052",
"GO:0030277",
"GO:0032501",
"GO:0032941",
"GO:0042592",
"GO:0044087",
"GO:0046903",
"GO:0048871"... | [] | [
"GO:0005575",
"GO:0005886",
"GO:0016020",
"GO:0030054",
"GO:0045202",
"GO:0071944",
"GO:0098794",
"GO:0098978",
"GO:0110165"
] | AF-P97288-F1-model_v6.pdb | 10090.ENSMUSP00000027560 | [
"Q61226",
"O70176",
"Q9R1C8",
"Q3UFE9",
"Q544U4",
"Q9D887",
"Q9Z1N8",
"Q8CGK7",
"Q5FW59",
"Q9QUN1",
"Q14A50"
] | [
"IPR017452",
"IPR001520",
"IPR000276"
] | {"IPR001520": [2, 359], "IPR000276": [21, 327], "IPR017452": [36, 312]} | - Guanine nucleotide-binding protein G(olf) subunit alpha
- VIP peptides
- VIP peptides
- Pro-opiomelanocortin
- 5-hydroxytryptamine receptor 6
- 5-hydroxytryptamine receptor 7
- Gastric inhibitory polypeptide
- Pro-glucagon
- Pituitary adenylate cyclase-activating polypeptide
- Natriuretic peptides A | - IPR017452: GPCR, rhodopsin-like, 7TM (domain) [36-312]
- IPR001520: 5-Hydroxytryptamine 4 receptor (family) [2-359]
- IPR000276: G protein-coupled receptor, rhodopsin-like (family) [21-327] | Molecular Function (MF): GO:0003674 (molecular function), GO:0060089 (molecular transducer activity), GO:0038023 (signaling receptor activity), GO:0004888 (transmembrane signaling receptor activity), GO:0099589 (serotonin receptor activity), GO:0004930 (G protein-coupled receptor activity), GO:0008227 (G protein-couple... |
Q7ZWC3 | Oxidized purine nucleoside triphosphate hydrolase | Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool. Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy- dATP) into 2-oxo-dAMP. Also has a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP. Through the hydrolysis of oxidized purine nuc... | Danio rerio (Zebrafish) (Brachydanio rerio) | 156 | Cytoplasm, cytosol. Mitochondrion matrix. Nucleus | MFTSKLLTLVLVVQPGRVLLGMKKRGFGAGKWNGFGGKVQTGETIEQAARRELLEESGLTVDTLHKIGNIKFEFIGETELMDVHIFRADNYEGEPAESDEMRPQWFDIDKIPFSQMWADDILWFPLMLQKKRFLGYFKFQGHDVIVEHKLDEVEDL | [
"GO:0006139",
"GO:0006163",
"GO:0006753",
"GO:0006793",
"GO:0006796",
"GO:0008150",
"GO:0008152",
"GO:0009117",
"GO:0009151",
"GO:0009262",
"GO:0009394",
"GO:0009987",
"GO:0019637",
"GO:0044238",
"GO:0044281",
"GO:0055086",
"GO:0072521",
"GO:1901135"
] | [
"GO:0006139",
"GO:0006163",
"GO:0006753",
"GO:0006793",
"GO:0006796",
"GO:0008150",
"GO:0008152",
"GO:0009117",
"GO:0009151",
"GO:0009262",
"GO:0009394",
"GO:0009987",
"GO:0019637",
"GO:0044238",
"GO:0044281",
"GO:0055086",
"GO:0072521",
"GO:1901135"
] | [] | [] | AF-Q7ZWC3-F1-model_v6.pdb | 7955.ENSDARP00000040752 | [
"Q6IQ66",
"E7F6K6",
"Q568Q0",
"Q1LXZ5",
"A0A2R8RL21",
"B0R135",
"Q6DG97",
"Q4V8V2",
"A0A0R4ISD4",
"F1QQK5"
] | [
"IPR020084",
"IPR003563",
"IPR000086",
"IPR020476",
"IPR015797"
] | {"IPR015797": [1, 147], "IPR003563": [4, 154], "IPR000086": [3, 129], "IPR020476": [32, 61], "IPR020084": [37, 58]} | - 8-oxo-dGDP phosphatase NUDT18
- Nucleotide triphosphate diphosphatase NUDT15
- ADP-sugar pyrophosphatase
- m7GpppN-mRNA hydrolase NUDT17
- Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
- Uridine diphosphate glucose pyrophosphatase NUDT14
- Nudix (nucleoside diphosphate-linked moiety X)-type motif 22
- N-glycosyla... | - IPR020084: NUDIX hydrolase, conserved site (conserved_site) [37-58]
- IPR003563: Oxidized purine nucleoside triphosphate (family) [4-154]
- IPR000086: NUDIX hydrolase domain (domain) [3-129]
- IPR020476: NUDIX hydrolase (domain) [32-61]
- IPR015797: NUDIX hydrolase-like domain superfamily (homologous_superfamily) [1-... | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016787 (hydrolase activity), GO:0016817 (hydrolase activity, acting on acid anhydrides), GO:0016818 (hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides)
Biological Process (BP): GO:0008150 (bio... |
Q568L5 | Aldo-keto reductase family 1 member A1-B | Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosaccharides and bile acids. Acts as an aldehyde-detoxification enzyme (By similari... | Danio rerio (Zebrafish) (Brachydanio rerio) | 324 | Cytoplasm, cytosol. Apical cell membrane | MNDFAVLSTGRKMPLLGLGTWKSEPGLVKQAVIWALESGYRHIDCAPIYANEPEIGEAFQETMGPDKGIRREDVFVTSKLWNTKHHPDDVEPSLLKTLKDLKLEYLDLYLIHWPYAFQRGDTPFPRKEDGTLLYDDIDYKLTWAAMEKLVGKGLVRAIGLSNFNSRQIDDILSVASIKPTVLQVESHPYLAQVELLSHCRDRGLVMTAYSPLGSPDRAWKHPDEPVLLEEPAIAALAKKYNKTPAQIIIRWQTQRGVVTIPKSITQSRIKENIQVFDFTLESEEMSQVTALHRGWRYIVPTITVDGKSVPRDAGHPHYPF... | [
"GO:0006109",
"GO:0006111",
"GO:0008150",
"GO:0009889",
"GO:0010906",
"GO:0019222",
"GO:0033500",
"GO:0042592",
"GO:0042593",
"GO:0043255",
"GO:0048878",
"GO:0050789",
"GO:0050794",
"GO:0062012",
"GO:0065007",
"GO:0080090",
"GO:0003674",
"GO:0003824",
"GO:0008106",
"GO:0016491"... | [
"GO:0006109",
"GO:0006111",
"GO:0008150",
"GO:0009889",
"GO:0010906",
"GO:0019222",
"GO:0033500",
"GO:0042592",
"GO:0042593",
"GO:0043255",
"GO:0048878",
"GO:0050789",
"GO:0050794",
"GO:0062012",
"GO:0065007",
"GO:0080090"
] | [
"GO:0003674",
"GO:0003824",
"GO:0008106",
"GO:0016491",
"GO:0016614",
"GO:0016616",
"GO:0018455"
] | [] | AF-Q568L5-F1-model_v6.pdb | 7955.ENSDARP00000119785 | [
"Q90ZZ8",
"B8A4B0",
"Q6P696",
"F6NZ60",
"A2BGR9",
"B0S7W5",
"Q7ZVB2",
"F8W5X0",
"B0UYA3",
"F8W5X3",
"Q6AZW2",
"Q90ZZ7",
"E9QH31",
"F1QGS9",
"F1QR17",
"Q4V8T0",
"F2Z4R7",
"F1QGP1",
"Q7ZWC2",
"X1WBM4",
"A0A2R8RIE8",
"Q802W2"
] | [
"IPR044481",
"IPR023210",
"IPR018170",
"IPR020471",
"IPR036812"
] | {"IPR036812": [2, 324], "IPR020471": [5, 307], "IPR044481": [7, 311], "IPR023210": [16, 291], "IPR018170": [39, 275]} | - Aldehyde dehydrogenase
- Beta-glucuronidase
- Glucuronokinase with putative uridyl pyrophosphorylase
- Klotho
- Monoglyceride lipase
- Aldo-keto reductase family 1 member A1-A
- Inositol oxygenase
- Aldehyde dehydrogenase
- Lactoylglutathione lyase
- Aldehyde dehydrogenase | - IPR044481: Aldo-keto reductase family 1 member A1 (family) [7-311]
- IPR023210: NADP-dependent oxidoreductase domain (domain) [16-291]
- IPR018170: Aldo/keto reductase, conserved site (conserved_site) [39-275]
- IPR020471: Aldo-keto reductase (family) [5-307]
- IPR036812: NAD(P)-dependent oxidoreductase domain superf... | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0016614 (oxidoreductase activity, acting on CH-OH group of donors), GO:0016616 (oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor)
Biological Process (B... |
P31037 | Protein A49R | Plays a role in the inhibition of host NF-kappa-B activation. Interacts with host BTRC and thereby diminishes ubiquitination of NF- kappa-B inhibitor alpha/NFKBIA. This stabilizes NFKBIA and its interaction with NF-kappaB, so retaining p65/RELA in the cytoplasm and preventing NF-kappa-B-dependent gene expression | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain | 162 | Host cytoplasm. Host nucleus | MDEAYYSGNLESVLGYVSDMHTELASISQLVIAKIETIDNDILNKDIVNFIMCRSNLDNPFISFLDTVYTIIDQENYQTELINSLDDNEIIDCIVNKFMSFYKDNLENIVDAIITLKYIMNNPDFKTTYAEVLGSRIADIDIKQVIRENILQLSNDIRERYL | [
"GO:0007154",
"GO:0007165",
"GO:0008150",
"GO:0009987",
"GO:0023052",
"GO:0035556",
"GO:0035821",
"GO:0038061",
"GO:0044003",
"GO:0044068",
"GO:0044403",
"GO:0044419",
"GO:0050789",
"GO:0050794",
"GO:0050896",
"GO:0051701",
"GO:0051716",
"GO:0052027",
"GO:0052029",
"GO:0065007"... | [
"GO:0007154",
"GO:0007165",
"GO:0008150",
"GO:0009987",
"GO:0023052",
"GO:0035556",
"GO:0035821",
"GO:0038061",
"GO:0044003",
"GO:0044068",
"GO:0044403",
"GO:0044419",
"GO:0050789",
"GO:0050794",
"GO:0050896",
"GO:0051701",
"GO:0051716",
"GO:0052027",
"GO:0052029",
"GO:0065007"... | [
"GO:0003674",
"GO:0140311",
"GO:0140313"
] | [
"GO:0005575",
"GO:0018995",
"GO:0030430",
"GO:0033643",
"GO:0033646",
"GO:0043656",
"GO:0044217",
"GO:0110165"
] | null | null | null | [
"IPR009473"
] | {"IPR009473": [1, 162]} | - IPR009473: Orthopoxvirus A49 (family) [1-162] | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0050896 (response to stimulus), GO:0016032 (viral process), GO:0044419 (biological process involved in interspecies interaction between organisms), GO... | |
Q01220 | Protein A52 | Bcl-2-like protein which targets host toll-like receptor signaling complexes to suppress innate immune response. Interacts with host TRAF6 to activate p38 and subsequently induce the expression of several cytokines such as IL-10. Also associates with host IRAK2 to inhibit NF-kappa-B signaling | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain | 190 | null | MDIKIDISISGDKFTVTTRRENEERKKYLPLQKEKTTDVIKPDYLEYDDLLDRDEMFTILEEYFMYRGLLGLRIKYGRLFNEIKKFDNDAEEQFGTIEELKQKLRLNSEEGADNFIDYIKVQKQDIVKLTVYDCISMIGLCACVVDVWRNEKLFSRWKYCLRAIKLFINDHMLDKIKSILQNRLVYVEMS | [
"GO:0007154",
"GO:0007165",
"GO:0007249",
"GO:0008150",
"GO:0009987",
"GO:0023052",
"GO:0035556",
"GO:0035821",
"GO:0038061",
"GO:0044003",
"GO:0044068",
"GO:0044403",
"GO:0044419",
"GO:0050789",
"GO:0050794",
"GO:0050896",
"GO:0051701",
"GO:0051716",
"GO:0052027",
"GO:0052029"... | [
"GO:0007154",
"GO:0007165",
"GO:0007249",
"GO:0008150",
"GO:0009987",
"GO:0023052",
"GO:0035556",
"GO:0035821",
"GO:0038061",
"GO:0044003",
"GO:0044068",
"GO:0044403",
"GO:0044419",
"GO:0050789",
"GO:0050794",
"GO:0050896",
"GO:0051701",
"GO:0051716",
"GO:0052027",
"GO:0052029"... | [] | [
"GO:0005575",
"GO:0018995",
"GO:0030430",
"GO:0033643",
"GO:0033646",
"GO:0043656",
"GO:0044217",
"GO:0110165"
] | null | null | null | [
"IPR043018",
"IPR022819"
] | {"IPR043018": [36, 190], "IPR022819": [20, 174]} | - IPR043018: Poxvirus domain superfamily (homologous_superfamily) [36-190]
- IPR022819: Poxvirus Bcl-2-like (family) [20-174] | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process),... | |
Q59RR0 | Cell wall transcription factor ACE2 | Transcription factor involved in the RAM (regulation of ACE2 transcription factor and polarized morphogenesis) signaling network that regulates polarized morphogenesis. Regulates expression of genes involved in cell separation such as CHT3, DSE1, and SCW11; or other cell wall genes such as ASH1, DSE4, PIR1, PRY2, and R... | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 783 | Nucleus. Note=Localized in the nuclei of daughter cells | MHWKFSNFRKYHLSFHLNLFDLSLFFISFYCFPILYICFFNQVHSFRSTQPSLIMNKFDLFDDYSTKGSTIPLPNENFDQLFLSSEANDMEFLFNETLMGLQDLDVPSGYGIPQNTINNDFQHTPNKSKSHSRQYSGTAIFGFADHNKDLSINGVNNDLCKQSNKAINTQSVSPGELLKRSRGSQTPTPTSALPDTAQDILDFNFEEKPILLLEEDELEEEKHKQQQRMMTQSSPLKRVTTPSQSPFVQQPQTMKQRKPHKKTNEYIVANENPNSYKFPPSPSPTAKRQQYPPSSPIPYNPKSDSVGGNSYSAKYLQSLN... | [
"GO:0006355",
"GO:0006357",
"GO:0007155",
"GO:0008150",
"GO:0009889",
"GO:0009891",
"GO:0009893",
"GO:0009987",
"GO:0010468",
"GO:0010556",
"GO:0010557",
"GO:0010564",
"GO:0010570",
"GO:0010604",
"GO:0010810",
"GO:0010811",
"GO:0016043",
"GO:0019219",
"GO:0019222",
"GO:0030155"... | [
"GO:0006355",
"GO:0006357",
"GO:0007155",
"GO:0008150",
"GO:0009889",
"GO:0009891",
"GO:0009893",
"GO:0009987",
"GO:0010468",
"GO:0010556",
"GO:0010557",
"GO:0010564",
"GO:0010570",
"GO:0010604",
"GO:0010810",
"GO:0010811",
"GO:0016043",
"GO:0019219",
"GO:0019222",
"GO:0030155"... | [] | [
"GO:0005575",
"GO:0005622",
"GO:0005634",
"GO:0043226",
"GO:0043227",
"GO:0043229",
"GO:0043231",
"GO:0110165"
] | AF-Q59RR0-F1-model_v6.pdb | 237561.Q59RR0 | [
"Q5ACY4",
"Q59U34",
"Q5AP53",
"Q5ABC6"
] | [
"IPR013087",
"IPR036236"
] | {"IPR036236": [647, 701], "IPR013087": [649, 706]} | - Serine/threonine-protein kinase CBK1
- Cdh1p
- CBK1 kinase activator protein MOB2
- Biofilm and cell wall regulator 1 | - IPR013087: Zinc finger C2H2-type (domain) [649-706]
- IPR036236: Zinc finger C2H2 superfamily (homologous_superfamily) [647-701] | Molecular Function (MF): GO:0003674 (molecular function), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0000981 (DNA-binding transcription factor activity, RNA polymerase II-specific)
Biological Process (BP): GO:0008150 (biological process), GO:0065007 (biolog... |
P83773 | Acetyl-CoA hydrolase | Presumably involved in regulating the intracellular acetyl- CoA pool for fatty acid and cholesterol synthesis and fatty acid oxidation | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 524 | Cytoplasm | MSAILKQRVRYAPYLKKLRTGEQCIDLFKHGQYLGWSGFTGVGAPKVIPTTLVDHVEKNNLQGKLGFHLFVGASAGPEESRWAENNMILTRAPHQVGKPIAAAINDGRTQFFDKHLSMFPQDLTYGFYTKDKPNGSNLDYTIIEATAITEDGSIVPGPAVGASPEMISVSDKIIIEVNTKTPSFEGIHDIDMPVNPPFRQPYPHTSADFKIGKTAIPVDPEKVVAIVESTSGDKVPPNTPSDEQSRGIANHLIEFLEHEVKQGRLPANLHPLQSGIGNIANAVVEGLASSNFKNLTVWTEVLQDSFLDFFESGSLDYATA... | [
"GO:0006082",
"GO:0006083",
"GO:0008150",
"GO:0008152",
"GO:0009268",
"GO:0009628",
"GO:0009987",
"GO:0010446",
"GO:0019752",
"GO:0032787",
"GO:0043436",
"GO:0044281",
"GO:0050896",
"GO:0051716",
"GO:0071214",
"GO:0071467",
"GO:0071469",
"GO:0104004",
"GO:0003674",
"GO:0003824"... | [
"GO:0006082",
"GO:0006083",
"GO:0008150",
"GO:0008152",
"GO:0009268",
"GO:0009628",
"GO:0009987",
"GO:0010446",
"GO:0019752",
"GO:0032787",
"GO:0043436",
"GO:0044281",
"GO:0050896",
"GO:0051716",
"GO:0071214",
"GO:0071467",
"GO:0071469",
"GO:0104004"
] | [
"GO:0003674",
"GO:0003824",
"GO:0003986",
"GO:0016289",
"GO:0016787",
"GO:0016788",
"GO:0016790",
"GO:0160215"
] | [
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0005739",
"GO:0005829",
"GO:0043226",
"GO:0043227",
"GO:0043229",
"GO:0043231",
"GO:0110165"
] | AF-P83773-F1-model_v6.pdb | 237561.P83773 | [
"Q5AH20",
"Q8NJN3",
"Q59TC4",
"A0A1D8PH52",
"A0A1D8PSH3",
"Q5AB86",
"Q5AGX8",
"A0A1D8PRR7",
"Q9P8Q2",
"A0A1D8PTB5",
"A0A1D8PM94",
"A0A1D8PSW6",
"A0A1D8PIF8",
"Q59XW4",
"A0A1D8PH13",
"Q59VG1",
"A0A1D8PC76",
"A0A1D8PGT5",
"Q5A8X6",
"A0A1D8PNQ8"
] | [
"IPR003702",
"IPR038460",
"IPR026888",
"IPR037171",
"IPR046433"
] | {"IPR037171": [6, 516], "IPR038460": [350, 496], "IPR046433": [2, 520], "IPR003702": [10, 228], "IPR026888": [329, 479]} | - Acetyl-coenzyme A synthetase 2
- Malate synthase
- Acetyl-coenzyme A synthetase
- Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
- Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
- Acetyl-CoA acetyltransferase
- Aldehyde dehydrogenase (NAD(P)(+))
- Acetyltransferase component of pyru... | - IPR003702: Acetyl-CoA hydrolase/transferase, N-terminal (domain) [10-228]
- IPR038460: Acetyl-CoA hydrolase/transferase, C-terminal domain superfamily (homologous_superfamily) [350-496]
- IPR026888: Acetyl-CoA hydrolase/transferase, C-terminal domain (domain) [329-479]
- IPR037171: NagB/RpiA transferase-like (homolog... | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016787 (hydrolase activity), GO:0016788 (hydrolase activity, acting on ester bonds), GO:0016782 (transferase activity, transferring sulphur-containing groups), GO:0008410 (CoA-transferase ac... |
Q4V9P6 | N6-Methyl-AMP deaminase | Catalyzes the hydrolysis of the free cytosolic methylated adenosine nucleotide N(6)-methyl-AMP (N6-mAMP) to produce inositol monophosphate (IMP) and methylamine. Is required for the catabolism of cytosolic N6-mAMP, which is derived from the degradation of mRNA containing N6-methylated adenine (m6A) | Danio rerio (Zebrafish) (Brachydanio rerio) | 348 | null | MDTEADLFYRQLPKVELHAHLNGSVSFETMEKLIKRKPHLNIEHSMTAIRRGQRRTLDECFQVFKVIHQLVDSEEDILMVAKSVIQEFAADGVKYLELRSTPREVTETGLSKQRYIETVLEAIRQCKQEGVDIDVRFLVAVDRRHGPEVAMQTVKLAEDFLLSSDGTVVGLDLSGDPTVGHGKDLLAALQKAKNCGLKLALHLSEVPSQIDETELLLNLPPDRIGHGTFLHPDVGGSDSLVDKVCKQNIPIEICLTSNVKGQTVPSYDKHHFKYWYNRGHPCVLCTDDKGVFCTDLSQEYQLAASTFGLTKEAVWILSQQ... | [
"GO:0001654",
"GO:0007275",
"GO:0007423",
"GO:0008150",
"GO:0032501",
"GO:0032502",
"GO:0043010",
"GO:0048513",
"GO:0048731",
"GO:0048856",
"GO:0048880",
"GO:0150063"
] | [
"GO:0001654",
"GO:0007275",
"GO:0007423",
"GO:0008150",
"GO:0032501",
"GO:0032502",
"GO:0043010",
"GO:0048513",
"GO:0048731",
"GO:0048856",
"GO:0048880",
"GO:0150063"
] | [] | [] | AF-Q4V9P6-F1-model_v6.pdb | 7955.ENSDARP00000067287 | [
"A0A0G2KGL2",
"Q6ZM69",
"F8W4R3",
"A0A0R4ISR7",
"F1QG13"
] | [
"IPR006330",
"IPR032466",
"IPR001365"
] | {"IPR032466": [8, 342], "IPR006330": [9, 345], "IPR001365": [13, 336]} | - IPR006330: Adenosine/adenine deaminase (family) [9-345]
- IPR032466: Metal-dependent hydrolase (homologous_superfamily) [8-342]
- IPR001365: Adenosine deaminase domain (domain) [13-336] | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016787 (hydrolase activity), GO:0016810 (hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds), GO:0016814 (hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines), GO:00192... | |
P05552 | Transcription factor Adf-1 | May play an important role not only in the regulation of Adh expression but also in the transcription of other genes | Drosophila melanogaster (Fruit fly) | 262 | Nucleus | MHTLTAAIEMDKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQHNKY | [
"GO:0006355",
"GO:0006357",
"GO:0008150",
"GO:0009889",
"GO:0010468",
"GO:0010556",
"GO:0019219",
"GO:0019222",
"GO:0050789",
"GO:0050794",
"GO:0051252",
"GO:0060255",
"GO:0065007",
"GO:0080090",
"GO:2001141",
"GO:0000976",
"GO:0000981",
"GO:0001067",
"GO:0003674",
"GO:0003676"... | [
"GO:0006355",
"GO:0006357",
"GO:0008150",
"GO:0009889",
"GO:0010468",
"GO:0010556",
"GO:0019219",
"GO:0019222",
"GO:0050789",
"GO:0050794",
"GO:0051252",
"GO:0060255",
"GO:0065007",
"GO:0080090",
"GO:2001141"
] | [
"GO:0000976",
"GO:0000981",
"GO:0001067",
"GO:0003674",
"GO:0003676",
"GO:0003677",
"GO:0003690",
"GO:0003700",
"GO:0005488",
"GO:0043565",
"GO:0140110",
"GO:1990837"
] | [] | AF-P05552-F1-model_v6.pdb | 7227.FBpp0303284 | [
"Q9VUH2"
] | [
"IPR039353",
"IPR006578",
"IPR004210"
] | {"IPR039353": [16, 260], "IPR006578": [24, 104], "IPR004210": [217, 256]} | - Transcription activator GAGA | - IPR039353: Transcription factor Adf-1 (family) [16-260]
- IPR006578: MADF domain (domain) [24-104]
- IPR004210: BESS motif (domain) [217-256] | Molecular Function (MF): GO:0003674 (molecular function), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0001216 (DNA-binding transcription activator activity), GO:0000981 (DNA-binding transcription factor activity, RNA polymerase II-specific), GO:0001228 (DNA-... |
Q5AF56 | Transcriptional regulator ADR1 | Transcription factor involved in the regulation of hyphal growth | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 1,418 | Nucleus | MISPTHQSQYLNYFVNPVLMTESGDIIDSVTGTTTTTANMSNTTIDAPTPASTTKNYKHKKQNTNTGTSMSPSNSINSTNNNAAAAAATTTTSKKSKDIPLELTAFGTTPSGKPRLFVCQVCTRAFARLEHLRRHERSHTKEKPFSCGVCQRKFSRRDLLLRHAQKLHAGCTDAITRLRRKSIKKSQDGDDDDDDDDDDEEMANSEDENDHDESGNASTKNGKKDKKDPPPEFNLNLFNSKQKPTKANTTKSKVAKLSTTTSRKNSTNPTRKNSSSLHKQVLDQRQKAAVNTKIVSSTKIVSGTNSGVSITPTRSRRGAS... | [
"GO:0006066",
"GO:0006109",
"GO:0006629",
"GO:0006694",
"GO:0006696",
"GO:0006950",
"GO:0006996",
"GO:0007031",
"GO:0008150",
"GO:0008152",
"GO:0008202",
"GO:0008204",
"GO:0008610",
"GO:0009058",
"GO:0009267",
"GO:0009607",
"GO:0009987",
"GO:0016043",
"GO:0016125",
"GO:0016126"... | [
"GO:0006066",
"GO:0006109",
"GO:0006629",
"GO:0006694",
"GO:0006696",
"GO:0006950",
"GO:0006996",
"GO:0007031",
"GO:0008150",
"GO:0008152",
"GO:0008202",
"GO:0008204",
"GO:0008610",
"GO:0009058",
"GO:0009267",
"GO:0009607",
"GO:0009987",
"GO:0016043",
"GO:0016125",
"GO:0016126"... | [
"GO:0001216",
"GO:0003674",
"GO:0003700",
"GO:0140110"
] | [] | AF-Q5AF56-F1-model_v6.pdb | 237561.Q5AF56 | [
"A0A1D8PN61",
"Q5A766"
] | [
"IPR013087",
"IPR051059",
"IPR036236"
] | {"IPR036236": [114, 163], "IPR051059": [98, 1403], "IPR013087": [117, 173]} | - DNA-binding transcription factor
- Carbon catabolite-derepressing protein kinase | - IPR013087: Zinc finger C2H2-type (domain) [117-173]
- IPR051059: Transcription factor verF-like (family) [98-1403]
- IPR036236: Zinc finger C2H2 superfamily (homologous_superfamily) [114-163] | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), ... |
Q9D1K7 | Adipose-secreted signaling protein | Adipocyte-secreted protein (adipokine) that acts as a key regulator for white adipose tissue (WAT) thermogenesis and glucose homeostasis at least in part through activation of protein kinase A (PKA) | Mus musculus (Mouse) | 174 | Secreted | MAAANRGSKPRVRSIRFAAGHDAEGSQSHVHFDEKLHDSVVMVTQESDNSFLVKVGFLKILHRYEITFTLPPVRRLSKDIRETPVHSLHLKLLSVTPTSEGYSIKCEYSAHKEGVLKEEMLLACEGDIGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEQSDWLGFD | [
"GO:0008150",
"GO:0008152",
"GO:0009987",
"GO:0033500",
"GO:0042592",
"GO:0042593",
"GO:0048878",
"GO:1990845",
"GO:0005575",
"GO:0005576",
"GO:0005615",
"GO:0110165"
] | [
"GO:0008150",
"GO:0008152",
"GO:0009987",
"GO:0033500",
"GO:0042592",
"GO:0042593",
"GO:0048878",
"GO:1990845"
] | [] | [
"GO:0005575",
"GO:0005576",
"GO:0005615",
"GO:0110165"
] | AF-Q9D1K7-F1-model_v6.pdb | 10090.ENSMUSP00000028800 | null | [
"IPR026794"
] | {"IPR026794": [1, 174]} | - IPR026794: Adipose-secreted signaling protein (family) [1-174] | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding), GO:0019899 (enzyme binding), GO:0019902 (phosphatase binding), GO:0019903 (protein phosphatase binding), GO:0008157 (protein phosphatase 1 binding)
Biological Process (BP): GO:0008150 (biological process), GO:0... | |
P37127 | Putative oxidoreductase AegA | Involved in formate-dependent uric acid degradation under microaerobic and anaerobic conditions. May reduce the enzymes necessary for uric acid degradation | Escherichia coli (strain K12) | 659 | null | MNRFIMANSQQCLGCHACEIACVMAHNDEQHVLSQHHFHPRITVIKHQQQRSAVTCHHCEDAPCARSCPNGAISHVDDSIQVNQQKCIGCKSCVVACPFGTMQIVLTPVAAGKVKATAHKCDLCAGRENGPACVENCPADALQLVTDVALSGMAKSRRLRTARQEHQPWHASTAAQEMPVMSKVEQMQATPARGEPDKLAIEARKTGFDEIYLPFRADQAQREASRCLKCGEHSVCEWTCPLHNHIPQWIELVKAGNIDAAVELSHQTNTLPEITGRVCPQDRLCEGACTIRDEHGAVTIGNIERYISDQALAKGWRPDL... | [
"GO:0008150",
"GO:0008152",
"GO:0009056",
"GO:0009987",
"GO:0019628",
"GO:0044281",
"GO:0044282",
"GO:0046415",
"GO:0072521",
"GO:0072523"
] | [
"GO:0008150",
"GO:0008152",
"GO:0009056",
"GO:0009987",
"GO:0019628",
"GO:0044281",
"GO:0044282",
"GO:0046415",
"GO:0072521",
"GO:0072523"
] | [] | [] | AF-P37127-F1-model_v6.pdb | 511145.b2468 | [
"Q2MAT2",
"Q2M900",
"P78239",
"Q2M6M5"
] | [
"IPR006006",
"IPR017900",
"IPR009051",
"IPR023753",
"IPR017896",
"IPR036188",
"IPR028261"
] | {"IPR009051": [161, 326], "IPR036188": [327, 651], "IPR006006": [187, 653], "IPR017896": [54, 145], "IPR028261": [205, 315], "IPR023753": [329, 640], "IPR017900": [87, 98]} | - Glutamate synthase [NADPH] large chain
- NAD-dependent dihydropyrimidine dehydrogenase subunit PreA
- Formate dehydrogenase H
- NADH-quinone oxidoreductase subunit F | - IPR006006: Glutamate synthase NADPH small chain-like (family) [187-653]
- IPR017900: 4Fe-4S ferredoxin, iron-sulphur binding, conserved site (conserved_site) [87-98]
- IPR009051: Alpha-helical ferredoxin (homologous_superfamily) [161-326]
- IPR023753: FAD/NAD(P)-binding domain (domain) [329-640]
- IPR017896: 4Fe-4S f... | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0005515 (protein binding), GO:0016491 (oxidoreductase activity), GO:0009055 (electron transfer activity)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:000998... |
Q8TGA2 | Fatty acid synthase alpha subunit aflA | Fatty acid synthase alpha subunit; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide- derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatox... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 1,671 | null | MVIQGKRLAASSIQLLASSLDAKKLCYEYDERQAPGVTQITEEAPTEQPPLSTPPSLPQTPNISPISASKIVIDDVALSRVQIVQALVARKLKTAIAQLPTSKSIKELSGGRSSLQNELVGDIHNEFSSIPDAPEQILLRDFGDANPTVQLGKTSSAAVAKLISSKMPSDFNANAIRAHLANKWGLGPLRQTAVLLYAIASEPPSRLASSSAAEEYWDNVSSMYAESCGITLRPRQDTMNEDAMASSAIDPAVVAEFSKGHRRLGVQQFQALAEYLQIDLSGSQASQSDALVAELQQKVDLWTAEMTPEFLAGISPMLDV... | [
"GO:0005575",
"GO:0005835",
"GO:0032991",
"GO:0140535",
"GO:1902494",
"GO:1990234"
] | [] | [] | [
"GO:0005575",
"GO:0005835",
"GO:0032991",
"GO:0140535",
"GO:1902494",
"GO:1990234"
] | AF-Q8TGA2-F1-model_v6.pdb | 1403190.Q8TGA2 | [
"A0A0F0IGH1",
"A0A0F0HZD0",
"A0A0F0IN54",
"A0A0F0I3U8",
"A0A0F0ILF1",
"A0A0F0IHY3",
"A0A0F0I549",
"A0A0F0I494",
"A0A0F0IK72",
"A0A0F0HZA4",
"A0A0F0III1",
"Q8TGA1",
"A0A0F0ILA6"
] | [
"IPR036291",
"IPR040899",
"IPR008278",
"IPR020841",
"IPR018201",
"IPR016039",
"IPR009081",
"IPR047224",
"IPR037143",
"IPR026025",
"IPR050830",
"IPR041550",
"IPR014030",
"IPR004568",
"IPR014031",
"IPR013968"
] | {"IPR036291": [492, 729], "IPR016039": [794, 1515], "IPR037143": [1547, 1665], "IPR026025": [10, 1666], "IPR050830": [25, 1493], "IPR040899": [74, 232], "IPR009081": [75, 153], "IPR041550": [259, 456], "IPR013968": [494, 569], "IPR020841": [833, 1428], "IPR047224": [994, 1425], "IPR014030": [1002, 1198], "IPR014031": [... | - Fatty acid synthase beta subunit aflB
- Acyl transferase domain protein
- Malonyl-CoA:ACP transacylase (MAT) domain-containing protein
- Acyl transferase domain protein
- Acetyl-CoA carboxylase central region
- Fatty acid synthase subunit alpha
- Ketosynthase family 3 (KS3) domain-containing protein
- Beta-ketoacyl s... | - IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [492-729]
- IPR040899: Fatty acid synthase subunit alpha, acyl carrier domain (domain) [74-232]
- IPR008278: 4'-phosphopantetheinyl transferase domain (domain) [1549-1642]
- IPR020841: Polyketide synthase, beta-ketoacyl synthase domain (domain) [83... | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016746 (acyltransferase activity), GO:0016747 (acyltransferase activity, transferring groups other than amino-acyl groups), GO:0004312 (fatty acid synthase activity)
Biological Process (BP):... |
Q8TGA1 | Fatty acid synthase beta subunit aflB | Fatty acid synthase beta subunit; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide- derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxi... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 1,888 | null | MGSVSREHESIPIQAAQRGAARICAAFGGQGSNNLDVLKGLLELYKRYGPDLDELLDVASNTLSQLASSPAAIDVHEPWGFDLRQWLTTPEVAPSKEILALPPRSFPLNTLLSLALYCATCRELELDPGQFRSLLHSSTGHSQGILAAVAITQAESWPTFYDACRTVLQISFWIGLEAYLFTPSSAASDAMIQDCIEHGEGLLSSMLSVSGLSRSQVERVIEHVNKGLGECNRWVHLALVNSHEKFVLAGPPQSLWAVCLHVRRIRADNDLDQSRILFRNRKPIVDILFLPISAPFHTPYLDGVQDRVIEALSSASLALH... | [
"GO:0005575",
"GO:0005835",
"GO:0032991",
"GO:0140535",
"GO:1902494",
"GO:1990234"
] | [] | [] | [
"GO:0005575",
"GO:0005835",
"GO:0032991",
"GO:0140535",
"GO:1902494",
"GO:1990234"
] | AF-Q8TGA1-F1-model_v6.pdb | 1403190.Q8TGA1 | [
"A0A0F0IN54",
"Q8TGA2",
"A0A0F0I3U8",
"A0A0F0ILF1",
"A0A0F0IGH1",
"A0A0F0HZD0",
"A0A0F0I2A0",
"A0A0F0III1",
"A0A0F0ILA6",
"A0A0F0IHY3",
"A0A0F0IK72",
"A0A0F0I494",
"A0A0F0HZA4"
] | [
"IPR001227",
"IPR013565",
"IPR029069",
"IPR039569",
"IPR040883",
"IPR016452",
"IPR003965",
"IPR050830",
"IPR002539",
"IPR013785",
"IPR014043",
"IPR032088",
"IPR016035"
] | {"IPR001227": [10, 1706], "IPR016035": [23, 1862], "IPR013785": [412, 695], "IPR029069": [1166, 1510], "IPR016452": [4, 1887], "IPR050830": [16, 1887], "IPR032088": [27, 257], "IPR003965": [434, 1704], "IPR013565": [581, 922], "IPR040883": [977, 1118], "IPR039569": [1134, 1255], "IPR002539": [1399, 1500], "IPR014043": ... | - Fatty acid synthase subunit alpha
- Fatty acid synthase alpha subunit aflA
- Fatty acid synthase subunit alpha
- Ketosynthase family 3 (KS3) domain-containing protein
- Beta-ketoacyl synthase C-terminal domain protein
- Acetyl-CoA carboxylase central region
- Acyl transferase domain protein
- Malonyl-CoA:ACP transacy... | - IPR001227: Acyl transferase domain superfamily (homologous_superfamily) [10-1706]
- IPR013565: Fatty acid synthase beta subunit AflB /Fas1-like, central domain (domain) [581-922]
- IPR029069: HotDog domain superfamily (homologous_superfamily) [1166-1510]
- IPR039569: FAS1-like, dehydratase domain region (domain) [113... | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016491 (oxidoreductase activity), GO:0016746 (acyltransferase activity), GO:0016627 (oxidoreductase activity, acting on the CH-CH group of donors), GO:0016747 (acyltransferase activity, tran... |
Q00278 | Norsolorinic acid ketoreductase | Norsolorinic acid ketoreductase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide- derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 271 | Cytoplasm, cytosol. Vacuole | MNGSLSQHDQERLSTPYRDGPPEETVYLVTGASRGIGRGLIEAFLQRPKSTVVAWLRNVRTATPALSALTVAEGSRMIIVQLNSDSETDAQAAVQTLREEHGVTHLDVVVANAAMATNFGPASTMPLEHLQAHMMVNMYAPVLLFQATRLMLQQSKQQAKFVLIGAPISTITNMHDYSRAPLTAYGVSKLAANYMVRKFHFENKWLTAFIIDPGHVQTDMGDQGARLMGRPQAPTTVADSVAGICARIDEATKETTSGHFVIHTDGSQLPW | [
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0005773",
"GO:0005775",
"GO:0031974",
"GO:0043226",
"GO:0043227",
"GO:0043229",
"GO:0043231",
"GO:0043233",
"GO:0070013",
"GO:0110165"
] | [] | [] | [
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0005773",
"GO:0005775",
"GO:0031974",
"GO:0043226",
"GO:0043227",
"GO:0043229",
"GO:0043231",
"GO:0043233",
"GO:0070013",
"GO:0110165"
] | AF-Q00278-F1-model_v6.pdb | 1403190.Q00278 | null | [
"IPR036291",
"IPR051468",
"IPR002347"
] | {"IPR036291": [26, 271], "IPR002347": [26, 247], "IPR051468": [27, 271]} | - IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [26-271]
- IPR051468: Fungal Secondary Metabolite SDRs (family) [27-271]
- IPR002347: Short-chain dehydrogenase/reductase SDR (family) [26-247] | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0016614 (oxidoreductase activity, acting on CH-OH group of donors), GO:0016616 (oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor)
Biological Process (B... | |
Q12732 | Averantin hydroxylase | Averantin hydroxylase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2),... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 495 | Membrane; Single-pass membrane protein | MGGDGWPSDGHILLLIVLTVLTPPSLALYRLWIHPLRSYPGPRWWAIWRGPYILSNIRGNLVRDLQRLHQQFGPVVRIAPNELSFIVPEAASPIYTSNPEFPKDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDKGLRHERSLIERSIDLLITQLHENCGQGPLDLALWFNWATFDIIGDLAFGDSFGCLENVQTHPWIASIQGNVKLIPILNAFRRYRLDGLLRLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPDGEPPMTRDEMISNASAIVLAGSETSATLLSGCTWLLLKNPSHLH... | [
"GO:0003674",
"GO:0003824",
"GO:0016491",
"GO:0016705",
"GO:0140395"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0016491",
"GO:0016705",
"GO:0140395"
] | [] | AF-Q12732-F1-model_v6.pdb | 1403190.Q12732 | [
"A0A0F0IM89",
"P87017"
] | [
"IPR050121",
"IPR017972",
"IPR001128",
"IPR002401",
"IPR036396"
] | {"IPR036396": [29, 495], "IPR050121": [13, 466], "IPR001128": [40, 469], "IPR002401": [69, 459], "IPR017972": [429, 438]} | - Short chain dehydrogenase
- 5'-hydroxyaverantin dehydrogenase | - IPR050121: Cytochrome P450 monooxygenase (family) [13-466]
- IPR017972: Cytochrome P450, conserved site (conserved_site) [429-438]
- IPR001128: Cytochrome P450 (family) [40-469]
- IPR002401: Cytochrome P450, E-class, group I (family) [69-459]
- IPR036396: Cytochrome P450 superfamily (homologous_superfamily) [29-495] | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0004497 (monooxygenase activity)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process),... |
P87017 | 5'-hydroxyaverantin dehydrogenase | 5'-hydroxyaverantin dehydrogenase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide- derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatox... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 278 | Cytoplasm, cytosol | MEVLDTTVDLGTLQGKSALITGGASGIGLATARAWAAAGMYVTIADIQPLETGQNILADLAGGHVHYVCCDVTSWESQITAFKEAIQFTPSKALDIVAAFAGVSFAGGNQVDHVLAAGDPRLDVNPSPPDIRNIQVNLIGVYYTSWLGLYYLRLSPTNKAANPSPDKSLILMGSIGSYMDSPKASTYPASKFGVRGLFRSTRARTRELGVRCNLLAPWFIDTPLIAPMKKAMAARGIDMAQRLTFASVDACVEAATTCAANPQLHGTPPIRYAYCLKT | [
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0005829",
"GO:0110165"
] | [] | [] | [
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0005829",
"GO:0110165"
] | AF-P87017-F1-model_v6.pdb | 1403190.P87017 | [
"Q12062",
"Q12732"
] | [
"IPR036291",
"IPR020904",
"IPR002347"
] | {"IPR036291": [12, 265], "IPR002347": [16, 229], "IPR020904": [174, 202]} | - Versicolorin B synthase
- Averantin hydroxylase | - IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [12-265]
- IPR020904: Short-chain dehydrogenase/reductase, conserved site (conserved_site) [174-202]
- IPR002347: Short-chain dehydrogenase/reductase SDR (family) [16-229] | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0003824 (catalytic activity), GO:0005515 (protein binding), GO:0016491 (oxidoreductase activity), GO:0042802 (identical protein binding), GO:0016614 (oxidoreductase activity, acting on CH-OH group of donors), GO:0046983 (protein dimeriza... |
Q12437 | Averufin oxidase A | Averufin oxidase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AFB2), afla... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 285 | Membrane; Single-pass membrane protein | MVTYALLGATGATGSSILRHLLQKSPDSLHIQVLVRSKVKLLQAFPDLETTRRPQVHVIQGMSTDSDALSECLRNASIVFMCVAQNGSPIGTTLCQDSARPIISVLQQQQQSEGASYQPCTIVQLRSASLNPALAAQVPAFVHRIVSFCLFANYADIKQACQYYSEAQKQGTLEYILVDPPTLHDANGTHPTGYRLISTEPQATALSYADLGAAMCEIAHRESEFHGRAVGVTATGRVRQTWGVLLRHLLEGGSSRLRETIAKEAVVVRVLCIFLVILACLMSSL | [
"GO:0003674",
"GO:0003824",
"GO:0016491"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0016491"
] | [] | AF-Q12437-F1-model_v6.pdb | 1403190.Q12437 | null | [
"IPR036291",
"IPR051606",
"IPR016040"
] | {"IPR036291": [3, 232], "IPR051606": [3, 234], "IPR016040": [8, 220]} | - IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [3-232]
- IPR051606: Polyketide Oxidoreductase-like (family) [3-234]
- IPR016040: NAD(P)-binding domain (domain) [8-220] | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0004497 (monooxygenase activity)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process),... | |
Q9UW95 | Versicolorin B desaturase | Versicolorin B desaturase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2 (AF... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 500 | Membrane; Single-pass membrane protein | MYFLSLPSLVIVIPVGYLLFHLGYNLFFHPLRGYPGPLLWRASSLPWKIALLRGTMHHDLMRFHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKDPVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLREVADTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHVLRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDNQRGDGMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIE... | [
"GO:0003674",
"GO:0003824",
"GO:0016491",
"GO:0016705",
"GO:0016717",
"GO:0140398"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0016491",
"GO:0016705",
"GO:0016717",
"GO:0140398"
] | [] | AF-Q9UW95-F1-model_v6.pdb | 1403190.Q9UW95 | null | [
"IPR050121",
"IPR017972",
"IPR001128",
"IPR002401",
"IPR036396"
] | {"IPR036396": [24, 497], "IPR050121": [7, 465], "IPR001128": [38, 468], "IPR002401": [177, 461], "IPR017972": [431, 440]} | - IPR050121: Cytochrome P450 monooxygenase (family) [7-465]
- IPR017972: Cytochrome P450, conserved site (conserved_site) [431-440]
- IPR001128: Cytochrome P450 (family) [38-468]
- IPR002401: Cytochrome P450, E-class, group I (family) [177-461]
- IPR036396: Cytochrome P450 superfamily (homologous_superfamily) [24-497] | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabolic process), GO:0019748 (secondary metabolic p... | |
P50161 | Versicolorin reductase 1 | Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), aflatoxin B2... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 262 | Cytoplasm, cytosol | MSDNHRLDGKVALVTGAGRGIGAAIAVALGERGAKVVVNYAHSREAAEKVVEQIKANGTDAIAIQADVGDPEATAKLMAETVRHFGYLDIVSSNAGIVSFGHLKDVTPEEFDRVFRVNTRGQFFVAREAYRHMREGGRIILTSSNTACVKGVPKHAVYSGSKGAIDTFVRCMAIDCGDKKITVNAVAPGAIKTDMFLAVSREYIPNGETFTDEQVDECAAWLSPLNRVGLPVDVARVVSFLASDTAEWVSGKIIGVDGGAFR | [
"GO:0003674",
"GO:0003824",
"GO:0016491",
"GO:0016614",
"GO:0042469",
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0005829",
"GO:0110165"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0016491",
"GO:0016614",
"GO:0042469"
] | [
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0005829",
"GO:0110165"
] | AF-P50161-F1-model_v6.pdb | 1403190.P50161 | [
"Q6UEF2"
] | [
"IPR036291",
"IPR020904",
"IPR002347",
"IPR057326"
] | {"IPR036291": [8, 260], "IPR002347": [11, 259], "IPR057326": [10, 194], "IPR020904": [145, 173]} | - Oxidoreductase aflX | - IPR036291: NAD(P)-binding domain superfamily (homologous_superfamily) [8-260]
- IPR020904: Short-chain dehydrogenase/reductase, conserved site (conserved_site) [145-173]
- IPR002347: Short-chain dehydrogenase/reductase SDR (family) [11-259]
- IPR057326: Ketoreductase domain (domain) [10-194] | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0016614 (oxidoreductase activity, acting on CH-OH group of donors), GO:0016616 (oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor)
Biological Process (B... |
Q12120 | Sterigmatocystin 8-O-methyltransferase | Sterigmatocystin 8-O-methyltransferase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), afl... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 418 | Cytoplasm. Vacuole | MALPSKAALVGLANTLSEQVKRYLATAGETKSPEDHKLCIESERTPSSNEHAQAWEIVRTCDRIGSLVHGPVPWLLSNALSHLDSACLAAATHLNLQDIIVDGPSPTSLDTIVAATGVSEDLLRRILRGCAQRFIFEEVAPDQYAHTDASKMLRVTGIHALVGFSCDEVMRSGASFSDFLQQTKGKPPSWNVPSPFSLAFDPTKGLFDYYSTVDEVRGRRFDLGMGGTEATKPLVEEMFDFSSLPEGSTVVDVGGGRGHLSRRVSQKHPHLRFIVQDLPAVIHGVEDTDKVTMMEHDIRRPNPVRGADVYLLRSILHDYP... | [
"GO:0003674",
"GO:0003824",
"GO:0008168",
"GO:0008171",
"GO:0016740",
"GO:0016741",
"GO:0047146",
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0005829",
"GO:0110165"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0008168",
"GO:0008171",
"GO:0016740",
"GO:0016741",
"GO:0047146"
] | [
"GO:0005575",
"GO:0005622",
"GO:0005737",
"GO:0005829",
"GO:0110165"
] | AF-Q12120-F1-model_v6.pdb | 1403190.Q12120 | [
"Q6UEG8",
"Q9UQY0",
"A0A0F0IBA6",
"A0A0F0IG46",
"O13345"
] | [
"IPR016461",
"IPR036388",
"IPR012967",
"IPR036390",
"IPR001077",
"IPR029063"
] | {"IPR036390": [65, 154], "IPR036388": [71, 153], "IPR029063": [158, 404], "IPR016461": [76, 415], "IPR012967": [80, 153], "IPR001077": [206, 387]} | - O-methylsterigmatocystin oxidoreductase
- Demethylsterigmatocystin 6-O-methyltransferase
- O-methyltransferase
- O-methyltransferase
- Aflatoxin biosynthesis regulatory protein | - IPR016461: O-methyltransferase-like (family) [76-415]
- IPR036388: Winged helix-like DNA-binding domain superfamily (homologous_superfamily) [71-153]
- IPR012967: O-methyltransferase, dimerisation domain (domain) [80-153]
- IPR036390: Winged helix DNA-binding domain superfamily (homologous_superfamily) [65-154]
- IPR... | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016740 (transferase activity), GO:0016741 (transferase activity, transferring one-carbon groups), GO:0008168 (methyltransferase activity), GO:0008171 (O-methyltransferase activity)
Biological Process (BP): GO:0008150 (biologi... |
O13345 | O-methylsterigmatocystin oxidoreductase | O-methylsterigmatocystin oxidoreductase; part of the gene cluster that mediates the biosynthesis of aflatoxins, a group of polyketide-derived furanocoumarins, and part of the most toxic and carcinogenic compounds among the known mycotoxins. The four major aflatoxins produced by A.parasiticus are aflatoxin B1 (AFB1), af... | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) | 528 | null | MIYSIIICAGALLGFLILQKLLAPKDTRPPLPPGPWRKPIIGNLTDFPPKGTPEWLFWAKHHERYGPMSSLEVMGQTIIMINDAHLGIEIMHKKSALSQMIPDAPFAHMAGWGMSLATERNKQAWKTIRANMKQEIGTRRAIATFHPKMEIGIRRFLLRTLDNPDDLRFHIRKEANAFMMDVAYGYTIAPHGKDELYDLTQQSVRQFSHIFSPGEWSVNFFPILRYVPSWFPGASFQIKAAEYKRTIERMTMVPYLWIKDQVARGCTRPSILLRLLQKGHYESGSHQEQVLVWTNAEFVMGGSDTTVSAVSSFFVAMALY... | [
"GO:0003674",
"GO:0003824",
"GO:0004497",
"GO:0016491"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0004497",
"GO:0016491"
] | [] | AF-O13345-F1-model_v6.pdb | 1403190.O13345 | [
"Q12120"
] | [
"IPR017972",
"IPR001128",
"IPR002401",
"IPR050364",
"IPR036396"
] | {"IPR036396": [23, 496], "IPR050364": [6, 507], "IPR001128": [32, 489], "IPR002401": [62, 463], "IPR017972": [433, 442]} | - Sterigmatocystin 8-O-methyltransferase | - IPR017972: Cytochrome P450, conserved site (conserved_site) [433-442]
- IPR001128: Cytochrome P450 (family) [32-489]
- IPR002401: Cytochrome P450, E-class, group I (family) [62-463]
- IPR050364: Cytochrome P450 monooxygenase, fungi (family) [6-507]
- IPR036396: Cytochrome P450 superfamily (homologous_superfamily) [23... | Molecular Function (MF): GO:0003674 (molecular function), GO:0003824 (catalytic activity), GO:0016491 (oxidoreductase activity), GO:0004497 (monooxygenase activity)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0009058 (biosynthetic process),... |
Q59Z29 | Iron-regulated transcriptional activator AFT2 | Transcription factor involved in iron metabolism, oxidative stress, surface adhesion, hyphal development and virulence. Functions as a negative regulator of MRS4 expression through the CACCC AFT-type sequence in a gene dose-dependent fashion. Acts as a repressor in flocculation, plastic adhesion, and surface hydrophobi... | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) | 798 | Nucleus | MTDRVTHRVSLDDLNLEKQKFDSKDDIKPWLQDNLQSTKGINVVIERSDTSKIIFKCKNKEKKTKIVESKKTASKTMIRKHTSCPFKIRANYSVRNKVWTLSIVSDEHDHVVDLPRSFVGKNLISNTIPGSSLNVLDSVAPRSNKKGIKPTSEIANTPSVTSYSPSCAVKRNEDVDAPKISSKKARNLTKKPSTQSTRSSSSSDGSSIVSFGSLTSQSSSTSLPENYKGQVPTSMDSMVVEESLTGKSLKPAASHPVKRKNMKANTMKKSKKLKQNPIVVSPIEEDSNLNSFDDANIDLQRQQSLQSPLSHLVQNQDPIS... | [
"GO:0002831",
"GO:0002833",
"GO:0006355",
"GO:0006357",
"GO:0006873",
"GO:0006879",
"GO:0006950",
"GO:0006979",
"GO:0007155",
"GO:0008150",
"GO:0009267",
"GO:0009607",
"GO:0009889",
"GO:0009891",
"GO:0009893",
"GO:0009987",
"GO:0010468",
"GO:0010556",
"GO:0010557",
"GO:0010570"... | [
"GO:0002831",
"GO:0002833",
"GO:0006355",
"GO:0006357",
"GO:0006873",
"GO:0006879",
"GO:0006950",
"GO:0006979",
"GO:0007155",
"GO:0008150",
"GO:0009267",
"GO:0009607",
"GO:0009889",
"GO:0009891",
"GO:0009893",
"GO:0009987",
"GO:0010468",
"GO:0010556",
"GO:0010557",
"GO:0010570"... | [] | [
"GO:0005575",
"GO:0005622",
"GO:0005634",
"GO:0043226",
"GO:0043227",
"GO:0043229",
"GO:0043231",
"GO:0110165"
] | AF-Q59Z29-F1-model_v6.pdb | 237561.Q59Z29 | [
"Q5AF81",
"Q59SS1"
] | [
"IPR014842"
] | {"IPR014842": [21, 111]} | - Monothiol glutaredoxin
- Ccc1p | - IPR014842: Iron-regulated transcriptional activator AFT (family) [21-111] | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:0003676 (nucleic acid binding), GO:0003677 (DNA binding)
Biological Process (BP): GO:0008150 (biological process), GO:0050789 (regulation of biolog... |
O67434 | Protein argonaute | A DNA-guided RNA endonuclease. Uses short ssDNA sequences as guides (gDNA) to bind complementary target strands, resulting in cleavage of the target RNA. The cleavage site is 10 nucleotides downstream of the residue base paired with the 5'-end of the gDNA. Binds ssDNA better than ssRNA, binds dsDNA and DNA- RNA hybrids... | Aquifex aeolicus (strain VF5) | 706 | null | MGKEALLNLYRIEYRPKDTTFTVFKPTHEIQKEKLNKVRWRVFLQTGLPTFRREDEFWCAGKVEKDTLYLTLSNGEIVELKRVGEEEFRGFQNERECQELFRDFLTKTKVKDKFISDFYKKFRDKITVQGKNRKIALIPEVNEKVLKSEEGYFLLHLDLKFRIQPFETLQTLLERNDFNPKRIRVKPIGIDFVGRVQDVFKAKEKGEEFFRLCMERSTHKSSKKAWEELLKNRELREKAFLVVLEKGYTYPATILKPVLTYENLEDEERNEVADIVRMEPGKRLNLIRYILRRYVKALRDYGWYISPEEERAKGKLNFKD... | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004521",
"GO:0004540",
"GO:0140098",
"GO:0140640"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004521",
"GO:0004540",
"GO:0140098",
"GO:0140640"
] | [] | AF-O67434-F1-model_v6.pdb | 224324.aq_1447 | [
"O67435",
"O67433"
] | [
"IPR003165",
"IPR012337",
"IPR003100",
"IPR036397",
"IPR036085"
] | {"IPR036085": [4, 314], "IPR012337": [334, 706], "IPR036397": [492, 705], "IPR003100": [168, 259], "IPR003165": [419, 694]} | - 8-OXO-dGTPase domain (MutT domain)
- Uncharacterized protein aq_1446 | - IPR003165: Piwi domain (domain) [419-694]
- IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [334-706]
- IPR003100: PAZ domain (domain) [168-259]
- IPR036397: Ribonuclease H superfamily (homologous_superfamily) [492-705]
- IPR036085: PAZ domain superfamily (homologous_superfamily) [4-314] | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process),... |
A4WYU7 | Protein argonaute | A catalytically inactive argonaute protein. Binds 5'- phosphorylated RNA as the guide (gRNA) and short DNA as target DNA (tDNA); does not bind other nucleic acid combinations, does not bind tDNA alone. Has highest affinity for gRNA that begins with 5'-phospho-U and poor affinity for gRNA with 5'-OH. Upon expression in ... | Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) (Rhodobacter | 777 | null | MAPVQAADEMYDSNPHPDRRQLVSNGFEVNLPDQVEVIVRDLPDPSKVKEERTRLMGYWFVHWFDGKLFHLRIKAGGPNVDGEHRAIRTAEHPWLLRARLDDALEEALPKYAAVKKRPFTFLAQKDELIDAAATAAGLSHRLLNSFKVIPRFALSPKIYEPVDGTTRVGVFVTIGMRYDIEASLRDLLEAGIDLRGMYVVRRKRQPGERGLLGRVRAISDDMVQLFEETDLASVNVNDAKLEGSKENFTRCLSALLGHNYKKLLNALDDQEAGYRTGPRFDDAVRRMGEFLAKKPIRLADNINAQVGDRIVFSNEGQARN... | [
"GO:0006950",
"GO:0006952",
"GO:0008150",
"GO:0009605",
"GO:0009607",
"GO:0043207",
"GO:0044355",
"GO:0044419",
"GO:0050896",
"GO:0051707",
"GO:0098542",
"GO:0099046",
"GO:0140546",
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0140097"... | [
"GO:0006950",
"GO:0006952",
"GO:0008150",
"GO:0009605",
"GO:0009607",
"GO:0043207",
"GO:0044355",
"GO:0044419",
"GO:0050896",
"GO:0051707",
"GO:0098542",
"GO:0099046",
"GO:0140546"
] | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0140097",
"GO:0140640"
] | [] | AF-A4WYU7-F1-model_v6.pdb | null | null | [
"IPR003165",
"IPR036397",
"IPR012337"
] | {"IPR012337": [321, 777], "IPR036397": [516, 777], "IPR003165": [445, 757]} | - IPR003165: Piwi domain (domain) [445-757]
- IPR036397: Ribonuclease H superfamily (homologous_superfamily) [516-777]
- IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [321-777] | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process),... | |
A0A1M5A5Z8 | Protein argonaute | A highly versatile argonaute that uses 5'-phospho- and 5'- OH- guide RNA (gRNA) or DNA (gDNA) to cleave target RNA or ssDNA (tDNA) in all possible combinations; has no detectable activity in the absence of guide. Uses short guide sequences (18-21 nucleotides (nt) on average) to bind complementary target nucleic acids r... | Marinitoga hydrogenitolerans (strain DSM 16785 / JCM 12826 / AT1271) | 640 | null | MYLNLYEIKIPYRVKRLYYFNKENDPKEFARNLSRVNNIRFNDSKDLVWLEIPDIDFKITPQQAEKYKIEKNEIIGEKEDSDLFVKTIYRYIKKKFIDNNFYYKRGNNYISINDKFPLDSNTNVNAHLTYKIKLYKINERYYISVLPKFTFLSDKPALESPIKSTYLFNIKSGKTFPYISGLNGVLKIDLGENGIKEVLFPENYYFNFTSKEAEKFGFSKEIHNIYKEKIFSGYKKIKQSLYFLEDIININNYNLTMDKKIYVNIEYEFKKGISRNIKDVFKYSFYKNDQKIKIAFFFSSKKQIYEIQRSLKMLFQNKNS... | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004521",
"GO:0004536",
"GO:0004540",
"GO:0140097",
"GO:0140098",
"GO:0140640"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004521",
"GO:0004536",
"GO:0004540",
"GO:0140097",
"GO:0140098",
"GO:0140640"
] | [] | AF-A0A1M5A5Z8-F1-model_v6.pdb | 1122195.SAMN02745164_02104 | [
"A0A1M5A5N0",
"A0A1M5A679",
"A0A1M5A5P1"
] | [
"IPR054434",
"IPR054387",
"IPR003165",
"IPR012337",
"IPR036397"
] | {"IPR012337": [410, 626], "IPR036397": [433, 604], "IPR054387": [13, 75], "IPR054434": [262, 430], "IPR003165": [369, 633]} | - CRISPR-associated endonuclease Cas1
- TOTE conflict system primase domain-containing protein
- CRISPR-associated endoribonuclease Cas2 | - IPR054434: Argonaute, middle domain, bacteria (domain) [262-430]
- IPR054387: Argonaute, N-terminal domain, bacteria (domain) [13-75]
- IPR003165: Piwi domain (domain) [369-633]
- IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [410-626]
- IPR036397: Ribonuclease H superfamily (homologous_superfam... | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process),... |
H2J4R4 | Protein argonaute | An RNA-guided ssDNA endonuclease that may play a role in defense against invading mobile genetic elements. Uses short 5'-OH- ssRNA sequences as guides (gRNA) to bind complementary target DNA (tDNA) or target RNA resulting in target cleavage. The cleavage site is 10 nucleotides (nt) downstream of the target residue base... | Marinitoga piezophila (strain DSM 14283 / JCM 11233 / KA3) | 639 | Cytoplasm | MYLNLYKIDIPKKIKRLYFYNPDMEPKLFARNLSRVNNFKFQDSNDLVWIEIPDIDFQITPKNVFQYKVEKEEIIKEEEDKKLFVKTLYKYIKKLFLDNDFYFKKGNNFISNSEVFSLDSNENVNAHLTYKIKIHNISNEYYLSILPKFTFLSKEPALESAIKSGYLYNIKSGKSFPYISGLDGILKIDIGNNQIVEVAYPENYLFNFTTRDAEKYGFSKEVHEIYKNKVFEGFKKIPKTLGFLNKITNLNENYQLKDGYKIFINVIYKFKNGESRYAKDVFKYSFYKNEQPLKAIFFFSSKKQFFEVQKSLKELFHNKH... | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0140097",
"GO:0140640"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0140097",
"GO:0140640"
] | [] | AF-H2J4R4-F1-model_v6.pdb | 443254.Marpi_0405 | [
"H2J4R1",
"H2J4R2",
"H2J4R3"
] | [
"IPR054434",
"IPR054387",
"IPR003165",
"IPR012337",
"IPR036397"
] | {"IPR012337": [415, 627], "IPR036397": [436, 634], "IPR054387": [12, 76], "IPR054434": [263, 432], "IPR003165": [394, 634]} | - CRISPR-associated endonuclease Cas1
- CRISPR-associated endoribonuclease Cas2
- TOTE conflict system primase domain-containing protein | - IPR054434: Argonaute, middle domain, bacteria (domain) [263-432]
- IPR054387: Argonaute, N-terminal domain, bacteria (domain) [12-76]
- IPR003165: Piwi domain (domain) [394-634]
- IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [415-627]
- IPR036397: Ribonuclease H superfamily (homologous_superfam... | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process),... |
Q58717 | Protein argonaute | A DNA-guided ssDNA endonuclease that may play a role in defense against invading genetic elements. Uses short ssDNA sequences as guides (gDNA) to bind complementary target strands, resulting in slicing of the target DNA (tDNA). Endonucleolytically cleaves tDNA (the gDNA indicates where to cleave); two major and two min... | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM | 713 | null | MVLNKVTYKINAYKIKEEFIPKEVHFYRIKSFVNEAFNFYRFVNFYGGMIINKKDKSFVLPYKVDNKVLKYKDGNNEIPIDIEYIKSLKLEYVKPEIAEKLVRGYLKSVHKIEPELSRIIKNIRKHKVVENIKVESYCEYEVKKHDGDYYLILNFRHTASITKHLWDFVNRDKALLEEYVGKKIIFKPNPKVRYTISLVDAPNPQKIEEIMSHIIKYYKWSEDMVKSTFGEIDYNQPIMYCEEILEPFAPQFCNLVFYMDELDSYILKELQSYWRLSNENKGKIINEIAKKLRFIDNTPKELEFMKFNNTPLLVKDVNKN... | [
"GO:0006950",
"GO:0006952",
"GO:0008150",
"GO:0009605",
"GO:0009607",
"GO:0043207",
"GO:0044355",
"GO:0044419",
"GO:0050896",
"GO:0051707",
"GO:0098542",
"GO:0099046",
"GO:0140546",
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0140097"... | [
"GO:0006950",
"GO:0006952",
"GO:0008150",
"GO:0009605",
"GO:0009607",
"GO:0043207",
"GO:0044355",
"GO:0044419",
"GO:0050896",
"GO:0051707",
"GO:0098542",
"GO:0099046",
"GO:0140546"
] | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0140097",
"GO:0140640"
] | [] | AF-Q58717-F1-model_v6.pdb | 243232.MJ_1321 | [
"Q58907",
"Q58719",
"Q58716",
"Q57841",
"Q58718"
] | [
"IPR003100",
"IPR054390",
"IPR012337",
"IPR003165",
"IPR054436",
"IPR036085",
"IPR036397"
] | {"IPR036085": [5, 305], "IPR012337": [301, 713], "IPR036397": [494, 713], "IPR054390": [22, 90], "IPR054436": [163, 258], "IPR003100": [164, 257], "IPR003165": [426, 699]} | - Uncharacterized protein MJ0398
- Reverse gyrase
- DNA double-strand break repair protein Mre11
- DNA double-strand break repair Rad50 ATPase
- Ribonuclease VapC4 | - IPR003100: PAZ domain (domain) [164-257]
- IPR054390: Argonaute, N-terminal domain, archaea (domain) [22-90]
- IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [301-713]
- IPR003165: Piwi domain (domain) [426-699]
- IPR054436: Argonaute, PAZ domain, methanocaldococcus (domain) [163-258]
- IPR036085... | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process),... |
Q8U3D2 | Protein argonaute | A DNA-guided ssDNA endonuclease that may play a role in defense against invading mobile genetic elements. Uses short 5'- phospho-ssDNA sequences as guides (gDNA) to bind complementary target strands, resulting in cleavage of the target DNA (tDNA). Endonucleolytically cleaves DNA in short dsDNA (the gDNA indicates where... | Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) | 770 | null | MKAKVVINLVKINKKIIPDKIYVYRLFNDPEEELQKEGYSIYRLAYENVGIVIDPENLIIATTKELEYEGEFIPEGEISFSELRNDYQSKLVLRLLKENGIGEYELSKLLRKFRKPKTFGDYKVIPSVEMSVIKHDEDFYLVIHIIHQIQSMKTLWELVNKDPKELEEFLMTHKENLMLKDIASPLKTVYKPCFEEYTKKPKLDHNQEIVKYWYNYHIERYWNTPEAKLEFYRKFGQVDLKQPAILAKFASKIKKNKNYKIYLLPQLVVPTYNAEQLESDVAKEILEYTKLMPEERKELLENILAEVDSDIIDKSLSEIE... | [
"GO:0006950",
"GO:0006952",
"GO:0008150",
"GO:0009605",
"GO:0009607",
"GO:0043207",
"GO:0044355",
"GO:0044419",
"GO:0050896",
"GO:0051707",
"GO:0098542",
"GO:0099046",
"GO:0140546",
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0005488"... | [
"GO:0006950",
"GO:0006952",
"GO:0008150",
"GO:0009605",
"GO:0009607",
"GO:0043207",
"GO:0044355",
"GO:0044419",
"GO:0050896",
"GO:0051707",
"GO:0098542",
"GO:0099046",
"GO:0140546"
] | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0005488",
"GO:0030145",
"GO:0036094",
"GO:0043167",
"GO:0043169",
"GO:0046872",
"GO:0046914",
"GO:0140097",
"GO:0140640"
] | [] | AF-Q8U3D2-F1-model_v6.pdb | 186497.PF0537 | null | [
"IPR003100",
"IPR012337",
"IPR057272",
"IPR003165",
"IPR021103",
"IPR036085",
"IPR036397",
"IPR055253"
] | {"IPR036085": [4, 323], "IPR012337": [325, 770], "IPR036397": [547, 770], "IPR055253": [19, 78], "IPR021103": [146, 272], "IPR003100": [154, 272], "IPR057272": [333, 753], "IPR003165": [473, 756]} | - IPR003100: PAZ domain (domain) [154-272]
- IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [325-770]
- IPR057272: Piwi domain, nematodes (domain) [333-753]
- IPR003165: Piwi domain (domain) [473-756]
- IPR021103: Argonaute PAZ domain, archaea (domain) [146-272]
- IPR036085: PAZ domain superfamily ... | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process),... | |
Q31N05 | Protein argonaute | A DNA-guided ssDNA endonuclease that might play a role in defense against invading mobile genetic elements. Uses short ssDNA sequences as guides (gDNA) to bind complementary target strands, resulting in cleavage of the target DNA (tDNA). The cleavage site is 10 nucleotides (nt) downstream of the target residue base-pai... | Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) | 735 | null | MDLLSNLRRSSIVLNRFYVKSLSQSDLTAYEYRCIFKKTPELGDEKRLLASICYKLGAIAVRIGSNIITKEAVRPEKLQGHDWQLVQMGTKQLDCRNDAHRCALETFERKFLERDLSASSQTEVRKAAEGGLIWWVVGAKGIEKSGNGWEVHRGRRIDVSLDAEGNLYLEIDIHHRFYTPWTVHQWLEQYPEIPLSYVRNNYLDERHGFINWQYGRFTQERPQDILLDCLGMSLAEYHLNKGATEEEVQQSYVVYVKPISWRKGKLTAHLSRRLSPSLTMEMLAKVAEDSTVCDREKREIRAVFKSIKQSINQRLQEAQK... | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0140097",
"GO:0140640"
] | [] | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0140097",
"GO:0140640"
] | [] | AF-Q31N05-F1-model_v6.pdb | 1140.Synpcc7942_1534 | null | [
"IPR040895",
"IPR003165",
"IPR036397",
"IPR012337"
] | {"IPR012337": [307, 732], "IPR036397": [507, 735], "IPR040895": [185, 276], "IPR003165": [441, 720]} | - IPR040895: Argonaute, PAZ domain (domain) [185-276]
- IPR003165: Piwi domain (domain) [441-720]
- IPR036397: Ribonuclease H superfamily (homologous_superfamily) [507-735]
- IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [307-732] | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0044237 (cellular metabolic process), GO:0071704 (organic substance metabolic process),... | |
Q746M7 | Protein argonaute | A DNA-guided ssDNA endonuclease. Uses short ssDNA sequences as guides (gDNA, also called small interfering DNA, siDNA) to bind complementary DNA target strands, resulting in cleavage of the target DNA (tDNA). The cleavage site is 10 nucleotides (nt) downstream of the target residue base-paired with the 5'-end of the gD... | Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) | 685 | null | MNHLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLARMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGRVAWVADPKDPRKPIPHLTGLLVPVLTLEDLHEEEGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPK... | [
"GO:0006950",
"GO:0006952",
"GO:0008150",
"GO:0009605",
"GO:0009607",
"GO:0043207",
"GO:0044355",
"GO:0044419",
"GO:0050896",
"GO:0051707",
"GO:0098542",
"GO:0099046",
"GO:0140546",
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0005488"... | [
"GO:0006950",
"GO:0006952",
"GO:0008150",
"GO:0009605",
"GO:0009607",
"GO:0043207",
"GO:0044355",
"GO:0044419",
"GO:0050896",
"GO:0051707",
"GO:0098542",
"GO:0099046",
"GO:0140546"
] | [
"GO:0003674",
"GO:0003824",
"GO:0004518",
"GO:0004519",
"GO:0004520",
"GO:0004536",
"GO:0005488",
"GO:0030145",
"GO:0036094",
"GO:0043167",
"GO:0043169",
"GO:0046872",
"GO:0046914",
"GO:0140097",
"GO:0140640"
] | [] | AF-Q746M7-F1-model_v6.pdb | null | null | [
"IPR040895",
"IPR012337",
"IPR003165",
"IPR054764",
"IPR054763",
"IPR003100",
"IPR036397"
] | {"IPR012337": [282, 685], "IPR036397": [467, 685], "IPR054764": [26, 96], "IPR003100": [169, 265], "IPR040895": [181, 263], "IPR054763": [327, 444], "IPR003165": [404, 671]} | - IPR040895: Argonaute, PAZ domain (domain) [181-263]
- IPR012337: Ribonuclease H-like superfamily (homologous_superfamily) [282-685]
- IPR003165: Piwi domain (domain) [404-671]
- IPR054764: Argonaute, N-terminal domain, thermus (domain) [26-96]
- IPR054763: Argonaute, middle domain (domain) [327-444]
- IPR003100: PAZ ... | Molecular Function (MF): GO:0003674 (molecular function), GO:0005488 (binding), GO:0005515 (protein binding)
Biological Process (BP): GO:0008150 (biological process), GO:0008152 (metabolic process), GO:0009987 (cellular process), GO:0016032 (viral process), GO:0009058 (biosynthetic process), GO:0044237 (cellular metabo... | |
Q8R4S7 | Aryl hydrocarbon receptor | Ligand-activated transcription factor that enables cells to adapt to changing conditions by sensing compounds from the environment, diet, microbiome and cellular metabolism, and which plays important roles in development, immunity and cancer. Upon ligand binding, translocates into the nucleus, where it heterodimerizes ... | Mus caroli (Ryukyu mouse) (Ricefield mouse) | 854 | Cytoplasm. Nucleus. Note=Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus | MSSGANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRNGGQDQCRAQIRDWQDLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTDSAQGVDEAHGPPQTAVYYTPDQLPPENASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGALLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPSGCDAKGQLILGYTEVELCTRGSGY... | [
"GO:0008150",
"GO:0009987",
"GO:0042221",
"GO:0050896",
"GO:0051716",
"GO:0070887",
"GO:1904612",
"GO:1904613",
"GO:0000981",
"GO:0003674",
"GO:0003700",
"GO:0004879",
"GO:0038023",
"GO:0060089",
"GO:0098531",
"GO:0140110",
"GO:0005575",
"GO:0005622",
"GO:0005634",
"GO:0043226"... | [
"GO:0008150",
"GO:0009987",
"GO:0042221",
"GO:0050896",
"GO:0051716",
"GO:0070887",
"GO:1904612",
"GO:1904613"
] | [
"GO:0000981",
"GO:0003674",
"GO:0003700",
"GO:0004879",
"GO:0038023",
"GO:0060089",
"GO:0098531",
"GO:0140110"
] | [
"GO:0005575",
"GO:0005622",
"GO:0005634",
"GO:0043226",
"GO:0043227",
"GO:0043229",
"GO:0043231",
"GO:0110165"
] | AF-Q8R4S7-F1-model_v6.pdb | null | null | [
"IPR036638",
"IPR035965",
"IPR033348",
"IPR013767",
"IPR011598",
"IPR000014",
"IPR013655",
"IPR001610",
"IPR039091"
] | {"IPR036638": [30, 80], "IPR035965": [120, 386], "IPR039091": [6, 811], "IPR011598": [26, 87], "IPR033348": [27, 87], "IPR000014": [111, 384], "IPR013767": [112, 185], "IPR013655": [298, 380], "IPR001610": [346, 387]} | - IPR036638: Helix-loop-helix DNA-binding domain superfamily (homologous_superfamily) [30-80]
- IPR035965: PAS domain superfamily (homologous_superfamily) [120-386]
- IPR033348: Aryl hydrocarbon receptor, basic helix-loop-helix domain (domain) [27-87]
- IPR013767: PAS fold (domain) [112-185]
- IPR011598: Myc-type, basi... | Molecular Function (MF): GO:0003674 (molecular function), GO:0060089 (molecular transducer activity), GO:0005488 (binding), GO:0140110 (transcription regulator activity), GO:0003700 (DNA-binding transcription factor activity), GO:0097159 (organic cyclic compound binding), GO:1901363 (heterocyclic compound binding), GO:... |
End of preview. Expand in Data Studio
🧬 BioReason-Pro
Advancing Protein Function Prediction with
Multimodal Biological Reasoning
BioReason-Pro RL Reasoning Data
Training dataset for reinforcement learning (GRPO) optimization of BioReason-Pro. Contains proteins with GO term annotations, InterPro domains, STRING protein-protein interactions, and protein metadata.
Citation
If you find this work useful, please cite our papers:
@article {Fallahpour2026.03.19.712954,
author = {Fallahpour, Adibvafa and Seyed-Ahmadi, Arman and Idehpour, Parsa and Ibrahim, Omar and Gupta, Purav and Naimer, Jack and Zhu, Kevin and Shah, Arnav and Ma, Shihao and Adduri, Abhinav and G{\"u}loglu, Talu and Liu, Nuo and Cui, Haotian and Jain, Arihant and de Castro, Max and Fallahpour, Amirfaham and Cembellin-Prieto, Antonio and Stiles, John S. and Nem{\v c}ko, Filip and Nevue, Alexander A. and Moon, Hyungseok C. and Sosnick, Lucas and Markham, Olivia and Duan, Haonan and Lee, Michelle Y. Y. and Salvador, Andrea F. M. and Maddison, Chris J. and Thaiss, Christoph A. and Ricci-Tam, Chiara and Plosky, Brian S. and Burke, Dave P. and Hsu, Patrick D. and Goodarzi, Hani and Wang, Bo},
title = {BioReason-Pro: Advancing Protein Function Prediction with Multimodal Biological Reasoning},
elocation-id = {2026.03.19.712954},
year = {2026},
doi = {10.64898/2026.03.19.712954},
publisher = {Cold Spring Harbor Laboratory},
URL = {https://www.biorxiv.org/content/early/2026/03/20/2026.03.19.712954},
eprint = {https://www.biorxiv.org/content/early/2026/03/20/2026.03.19.712954.full.pdf},
journal = {bioRxiv}
}
@misc{fallahpour2025bioreasonincentivizingmultimodalbiological,
title={BioReason: Incentivizing Multimodal Biological Reasoning within a DNA-LLM Model},
author={Adibvafa Fallahpour and Andrew Magnuson and Purav Gupta and Shihao Ma and Jack Naimer and Arnav Shah and Haonan Duan and Omar Ibrahim and Hani Goodarzi and Chris J. Maddison and Bo Wang},
year={2025},
eprint={2505.23579},
archivePrefix={arXiv},
primaryClass={cs.LG},
url={https://arxiv.org/abs/2505.23579},
}
- Downloads last month
- 38
Models trained or fine-tuned on wanglab/bioreason-pro-rl-reasoning-data